Protein coding transcript 130448

• Transcript: Ll_transcript_27791
• CDS coordinates: 63-518 (+)
• Peptide sequence: MFRSVAVRGVSLLKTAVKVNKPSVAATTRFMSHGPTETDEQFDARYENFFNRKDIDGWEIRQGINDLWGHDLVPEPKILIAALKACRRVNDFALAVRILEALKDKCGSKVSEIYPYVMQEIKPTLSELGISTPEELGFDKPQLALKSVYDM*
• ORF Type: complete

Annotations of Ll_transcript_27791

• Blastp: Cytochrome c oxidase subunit 5A, mitochondrial from Sophophora with 55.78% of identity
• Blastx: Cytochrome c oxidase subunit 5A, mitochondrial from Sophophora with 55.78% of identity
• Eggnog: cytoChrome c oxidase subunit(ENOG4111MPD)
• Kegg: Link to kegg annotations (Dmel_CG14724)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003539564.1)
• Pfam: Cytochrome c oxidase subunit Va (PF02284.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;