Protein coding transcript 130451

• Transcript: Ll_transcript_32986
• CDS coordinates: 214-570 (+)
• Peptide sequence: MASKNSQAQFQDYLPVMANKLGGDGLIDELCNGFNLLMDSEKGVITFESLKRNSALLGLQDLSDQDLQSMVVEGDFDGDGALNQLEFCVLMFRLSPELMEGSQLWLEQALQGELKDFF*
• ORF Type: complete

Annotations of Ll_transcript_32986

• Blastp: Calcium-binding protein PBP1 from Arabidopsis with 63.39% of identity
• Blastx: Calcium-binding protein PBP1 from Arabidopsis with 60.71% of identity
• Eggnog: Calcium-binding protein(COG5126)
• Kegg: Link to kegg annotations (AT5G54490)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426376.1)
• Pfam: EF-hand domain pair (PF13833.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;