Protein coding transcript 130454

• Transcript: Ll_transcript_32984
• CDS coordinates: 2-913 (+)
• Peptide sequence: IVIYSFFKNNVAVADSKMTSLQEHVNNLCIANVREHALFELSKRTELFDDLAILLWTTSSVMTALLQEIIAIYPDLSNESLTLVKSNRVCNVLALFQCVASHPDTRMPFISAQMPIYVYPLLYTRFKSKPFEYLRLASVGVIGALVKVDDTKVVTFLTCTEVMPMCLCTMEVGSELTKTVATFIVQKILLDDVGLQHVCASAERFTAVVRGFGNMLAYLATKHSPRLFKRIIRCYLRLSDDPRGGDALRRWLPTMLTDGTFRTYLHDDPTTRAWLQQLLDKVGGNRDNGVGGGLDYLMNNFRI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_32984

• Blastp: CCR4-NOT transcription complex subunit 9 from Silurana with 52.4% of identity
• Blastx: CCR4-NOT transcription complex subunit 9 from Silurana with 52.79% of identity
• Eggnog: cell differentiation protein Rcd1(COG5209)
• Kegg: Link to kegg annotations (394620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452030.1)
• Pfam: Cell differentiation family, Rcd1-like (PF04078.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;