Protein coding transcript 130456

• Transcript: Ll_transcript_32998
• CDS coordinates: 2-559 (+)
• Peptide sequence: PTVEVDLVTELGLFRAAVPSGASTGVHEALELRDNDKSQYHGKSVQKAIDNVNNLIAPELIKAGLEVTQQKEIDELMLKLDGTENKSKLGANAILGVSLAVCKAGAAKKGVPLYKHIADLAGNSTIVLPTPAFNVINGGSHAGNKLAMQEFMILPTGASSFKEAMTMGSEVYHHLKNIIKATLGLD
• ORF Type: internal

Annotations of Ll_transcript_32998

• Blastp: Enolase from Homarus with 77.96% of identity
• Blastx: Enolase from Homarus with 77.96% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003551250.1)
• Pfam: Enolase, N-terminal domain (PF03952.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;