Protein coding transcript 130458

• Transcript: Ll_transcript_269581
• CDS coordinates: 3-593 (+)
• Peptide sequence: RQRDSINDFKNPAVFAYYNVDYVKNVKGTNYWRNRILKIAQNYADDFTFAICSKDDFQHELNEFGIDYVPGDKPKIAARNAKDQKFIMKDEFSMESFEQFLKDLLAGTLEPFLKSEPIPDDNSGPVKVAVAKNFDEIVTNNDKDILIEFYAPWCGHCKKLAPVWDELGEKLKDEDVEIVKMDASNNDVPSPFEVRGL
• ORF Type: internal

Annotations of Ll_transcript_269581

• Blastp: Protein disulfide-isomerase A3 from Gallus with 57.37% of identity
• Blastx: Protein disulfide-isomerase A3 from Gallus with 57.37% of identity
• Eggnog: Thioredoxin(COG0526)
• Kegg: Link to kegg annotations (373899)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016163495.1)
• Pfam: Thioredoxin-like domain (PF13848.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;