Protein coding transcript 130460

• Transcript: Ll_transcript_269552
• CDS coordinates: 2-397 (+)
• Peptide sequence: HNTFNALRTEQRQLATKLSEIELDLNEHSIVIDTLNKLDDERKCFRLIGGVLGERKICDVLPTLIKNRGEMGKIVKTLNEQLTKKGIEINEFKNKHNIQVKGGVTPMTEEVESQSVDKKADHGGSVIVNNV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_269552

• Blastp: Prefoldin subunit 2 from Mus with 47.58% of identity
• Blastx: Prefoldin subunit 2 from Mus with 47.58% of identity
• Eggnog: prefoldin subunit 2(ENOG4111S6I)
• Kegg: Link to kegg annotations (18637)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453484.1)
• Pfam: Prefoldin subunit (PF01920.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;