Transcript | Ll_transcript_269692 |
---|---|
CDS coordinates | 18-677 (+) |
Peptide sequence | MALMLASRLCRAPVLNNVAVKSLPNYAAKRVFSEEGKDALGRAIRRSPTIKELAMAPAGDTAFNIGRSALAGGSVLGIGALCYYGVGLGKDVGALEKHHLWPQYVKDRIKTTYLYFGSSLVVTAASAVAAASSPAIMNLVMRNGFMGMAISLAAIMGTGMLAQGIEYKEGFGAKQMAWLLHTATMGAMVAPLCFLGGPLLIRAAWYTAGVVGGLSTIAVC |
ORF Type | 3prime_partial |
Blastp | Growth hormone-inducible transmembrane protein from Homo with 47.17% of identity |
---|---|
Blastx | Growth hormone-inducible transmembrane protein from Homo with 47.17% of identity |
Eggnog | growth hormone inducible transmembrane protein(ENOG410XPHY) |
Kegg | Link to kegg annotations (27069) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_014505735.1) |
Pfam | Inhibitor of apoptosis-promoting Bax1 (PF01027.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer