Protein coding transcript 130466

• Transcript: Ll_transcript_269716
• CDS coordinates: 3-344 (+)
• Peptide sequence: ESDTIYLKTLDPKEWKDQDHYQVLGLSKLRYKATEAQIKSAYRRRVLNHHPDKRKKLGEKVQGDDDYFTCITKAWETLGNKTKRRAYDSIDPKFDNSIPSKEMAKKSDFFQLFG
• ORF Type: internal

Annotations of Ll_transcript_269716

• Blastp: DnaJ homolog subfamily C member 2 from Rattus with 64.22% of identity
• Blastx: DnaJ homolog subfamily C member 2 from Rattus with 64.22% of identity
• Eggnog: Transcription factor(COG5269)
• Kegg: Link to kegg annotations (116456)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003540155.1)
• Pfam: DnaJ domain (PF00226.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;