Protein coding transcript 130468

• Transcript: Ll_transcript_269719
• CDS coordinates: 2-664 (-)
• Peptide sequence: MLKPPFHSDLYVYLLQSAIKTRDPFLGRSIHAQIIKHGLHLGLFLMNNLLNFYAKTDTFSHAHSLFDEMPLKTTFSWNTILSAYAKGGNLKTAHHVFDLIPHPDSVSWTTMIVGYNQMGLFHDGIHMFLNMVSHGISPTQFTFTNVLASCAATRALDTGRKVHSFIVKLGLSGVVPVANSLVNMYSKSGDTVMAKIIFDRMRLKDKSSWNTMISMHMQLGR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_269719

• Blastp: Pentatricopeptide repeat-containing protein At2g22070 from Arabidopsis with 56.54% of identity
• Blastx: Pentatricopeptide repeat-containing protein At2g22070 from Arabidopsis with 56.54% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT2G22070)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428132.1)
• Pfam: PPR repeat (PF01535.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;