Protein coding transcript 130478

• Transcript: Ll_transcript_239864
• CDS coordinates: 941-1318 (+)
• Peptide sequence: MLLYVCGAATVSCSACLTINRVPACNQLIYIDCGNCRTTLMFSNGASSVKCAICNHVTVVSMPNEMFLFPDVSPNGMTNSATDSSTSTSMPQSQNQTVIVENPMSVDPNGNLVSNVVLGVITGKK*
• ORF Type: complete

Annotations of Ll_transcript_239864

• Blastp: Protein LOL2 from Oryza sativa with 51.2% of identity
• Blastx: Protein LOL2 from Oryza sativa with 50% of identity
• Eggnog: LSD1 zinc finger domain containing protein, expressed(ENOG4111MH5)
• Kegg: Link to kegg annotations (4352767)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431823.1)
• Pfam: LSD1 zinc finger (PF06943.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;