Protein coding transcript 130480

• Transcript: Ll_transcript_239866
• CDS coordinates: 2-658 (+)
• Peptide sequence: ITVCQIKYALDLLCDTGFLNYKLVATPMVKNTRLHLNDGMPYSHAMYYRQLVGRLLYLTNTRPDLSSSLQQLSQFMTNPTLTHYSAISRVLRYIKTSLGHDLFYPSNSIIHIKGFSDSDWETCPDTRKYVSGYCMFLDNALVSWKSKKQNTVSRSSFEAKYRALAVASCEVQWLTYLLQDFQLLYKQPAILYCDNASAHYIAANHVFHERTKHVEIDFH
• ORF Type: internal

Annotations of Ll_transcript_239866

• Blastp: Uncharacterized mitochondrial protein AtMg00810 from Arabidopsis with 41.28% of identity
• Blastx: Uncharacterized mitochondrial protein AtMg00810 from Arabidopsis with 40.8% of identity
• Eggnog: Retrotransposon protein(COG2801)
• Kegg: Link to kegg annotations (ArthMp070)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435862.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;