| Transcript | Ll_transcript_239836 |
|---|---|
| CDS coordinates | 3-449 (+) |
| Peptide sequence | GSLPTARCSLSGSPIPGHNKAYVFGGVYDEEQGEDDLTSTFYNELYMLDMEQNTPTWRFISVKELASEEAQNLVNSETPAPTPRSHSGLAFKHNTLFVYGGIVEKGSKSLTLSDFYSLDIKKLKKWNVICNDDILKTVTSDCSSDDSMS |
| ORF Type | internal |
| Blastp | Kelch domain-containing protein 4 from Pongo with 39.39% of identity |
|---|---|
| Blastx | Kelch domain-containing protein 4 from Pongo with 39.39% of identity |
| Eggnog | kelch domain containing 4(ENOG410XPJI) |
| Kegg | Link to kegg annotations (100172995) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_004501827.1) |
| Pfam | Galactose oxidase, central domain (PF13418.5) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer