Protein coding transcript 130484

• Transcript: Ll_transcript_239818
• CDS coordinates: 2-511 (-)
• Peptide sequence: VGFNFINGSLPSSLQSWTGLSSLILKENRFSGGIPAFLSQFERLYELQLGGNMLGGRIPGSIGALQNLIYGLNLSSNGLIGDIPVEIGNLKSLLMLDLSKNNLTGSIEALDDLHSLVKINISYNSFHGPVPKMLMKLLNSPMTSFMGNPGLCINCSPSDGSVCNEITYLR
• ORF Type: internal

Annotations of Ll_transcript_239818

• Blastp: Leucine-rich repeat receptor-like protein kinase PEPR1 from Arabidopsis with 52.29% of identity
• Blastx: Leucine-rich repeat receptor-like protein kinase PEPR1 from Arabidopsis with 52.29% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G73080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448016.1)
• Pfam: Leucine rich repeat (PF13855.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;