Protein coding transcript 130486

• Transcript: Ll_transcript_239831
• CDS coordinates: 131-718 (+)
• Peptide sequence: MDNLRFNSASSNVKDYYEVSESRKQVLDHIMEALIAPNINMIGVCGKDDDNIASLLQRVIRRGWRDNLFGMIVMIRIGENPDIRRIQEEIAHEIGCSFQRQVKQDKKTRCCGFNYFEFHSANTKKFDTENAQQLFDKIRSVPKIMFILRDVRSRLDLGKVGIPFGVDHQGCKLIFISESDDILSNHMNAQCTFIF*
• ORF Type: complete

Annotations of Ll_transcript_239831

• Blastp: Probable disease resistance protein At5g47260 from Arabidopsis with 20.99% of identity
• Blastx: Probable disease resistance protein At5g47260 from Arabidopsis with 21.6% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT5G47260)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003532765.2)
• Pfam: NB-ARC domain (PF00931.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;