| Transcript | Ll_transcript_270275 |
|---|---|
| CDS coordinates | 3-341 (+) |
| Peptide sequence | DVGLMGPEGPKGEKGMFGEYGSEGEKGPRGDNGPQGIQGLEGRFGAPGEEGFRGPPGLDGCNGTDGAMGIDGIPGRPGERGAPGPMGLQGFRGEPGDGGGNSMGIKGNYGIIG |
| ORF Type | internal |
| Blastp | Collagen alpha-2(I) chain from Rattus with 46.02% of identity |
|---|---|
| Blastx | Collagen-like protein 4 from Mimivirus with 38.74% of identity |
| Eggnog | collagen, type(ENOG410ZZWR) |
| Kegg | Link to kegg annotations (84352) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | - |
| Pfam | Collagen triple helix repeat (20 copies) (PF01391.17) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer