Protein coding transcript 130494

• Transcript: Ll_transcript_270271
• CDS coordinates: 36-389 (+)
• Peptide sequence: MASEMMKVLVKENEPKAEIWMHKELIQVDCKENGQVLSIIFLKEKLFSGHSDGTIKVWKIQDSLIHLLQETQEHMKDVTSLAISESGDRLYSGSLDRTVKVWFIGKTGIHHIQVHDMK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_270271

• Blastp: Putative E3 ubiquitin-protein ligase LIN-1 from Lotus with 47.06% of identity
• Blastx: Putative E3 ubiquitin-protein ligase LIN-1 from Lotus with 46.92% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435822.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;