Protein coding transcript 130496

• Transcript: Ll_transcript_270309
• CDS coordinates: 58-807 (+)
• Peptide sequence: MSSKDRLPIFPSRGAQMLMKARLKGAQKGHSLLKKKADALQMRFRMILSKIIETKTLMGEVMKEASFSLAEAKFATGDFNQVVLQNVTKAWLKIKTKKDNVAGVTLPVFEWYEDGTDPNMLAGLSRGGQQLTKLKKNYQSAVKLLVELASLQTSFVTLDDVIKITNRRVNAIEHVIIPRIERTLAYIISELDELEREEFYRLKKIQDKKKIIKAKAEKIKAELKAAGLLAEAQESGNNMLDEGDEDILF*
• ORF Type: complete

Annotations of Ll_transcript_270309

• Blastp: V-type proton ATPase subunit D 1 from Sophophora with 81.53% of identity
• Blastx: V-type proton ATPase subunit D 1 from Sophophora with 81.53% of identity
• Eggnog: Produces ATP from ADP in the presence of a proton gradient across the membrane (By similarity)(COG1394)
• Kegg: Link to kegg annotations (Dmel_CG8186)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015960547.1)
• Pfam: ATP synthase subunit D (PF01813.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;