Transcript | Ll_transcript_270265 |
---|---|
CDS coordinates | 1-507 (+) |
Peptide sequence | VQLGNLSKKVQSAEEIAQVATISANGDTSIGQLISSAMEKVGKDGVITVKDGKTLEDELEVIEGLKFDRGYISPYFINSAKGAKVEFQDALVLFSEKKISSAQSLIPALELANAQRKPLVIVAEDLDGEVIGMLVLNRLKIGLNVAAVKAPGFGDNRKSTLTDMAIATG |
ORF Type | internal |
Blastp | 60 kDa heat shock protein, mitochondrial from Sophophora with 82.04% of identity |
---|---|
Blastx | 60 kDa heat shock protein, mitochondrial from Sophophora with 82.04% of identity |
Eggnog | Prevents misfolding and promotes the refolding and proper assembly of unfolded polypeptides generated under stress conditions (By similarity)(COG0459) |
Kegg | Link to kegg annotations (Dmel_CG12101) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019435425.1) |
Pfam | TCP-1/cpn60 chaperonin family (PF00118.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer