Protein coding transcript 130498

• Transcript: Ll_transcript_270266
• CDS coordinates: 1-732 (+)
• Peptide sequence: EDIKAGDFGEVKEVVITKDDTLLLKGNGIPSDIEQRAEQIRDQIKDTSSEYEKEKLQERLARLASGVAVLKIGGSSEVEVNEKKDRVTDALNATRAAVEEGIVPGGGTALIRCGPGLNAIKVANKDQKIGIDIVRKALTMPCMTIARNAGVDAGVVVAKVSEGKDAFGYDAMNDEYVNMVEKGIIDPTKVVRTAITDAAGVASLLTTAEAVITELPKKEEPLPGGGMGGMGGMGGMGGMGGMM*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_270266

• Blastp: 60 kDa heat shock protein, mitochondrial from Sophophora with 73.06% of identity
• Blastx: 60 kDa heat shock protein, mitochondrial from Sophophora with 73.06% of identity
• Eggnog: Prevents misfolding and promotes the refolding and proper assembly of unfolded polypeptides generated under stress conditions (By similarity)(COG0459)
• Kegg: Link to kegg annotations (Dmel_CG12101)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003556325.1)
• Pfam: TCP-1/cpn60 chaperonin family (PF00118.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;