Protein coding transcript 130503

• Transcript: Ll_transcript_69882
• CDS coordinates: 77-580 (+)
• Peptide sequence: MAPNITTTALNATAEKPKNGGGSGHAFVTFLAGNGDYVKGVVGLAKGLRKVKSEYPLVVAVLHDVPEEHRKILNSQGCIVREIEPVYPPKNQTHFAMAYYVINYSKLRIWEFVEYKKMIYLDGDIQVFENIDHLFDLPDNYFYAVMDCFCEKSWTHTPQYQIGYCQQC
• ORF Type: 3prime_partial

Annotations of Ll_transcript_69882

• Blastp: Galactinol synthase 1 from Arabidopsis with 78.03% of identity
• Blastx: Galactinol synthase 1 from Arabidopsis with 78.03% of identity
• Eggnog: Glycosyl Transferase(COG5597)
• Kegg: Link to kegg annotations (AT2G47180)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418197.1)
• Pfam: Glycosyl transferase family 8 (PF01501.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;