Protein coding transcript 130504

• Transcript: Ll_transcript_69902
• CDS coordinates: 2-430 (+)
• Peptide sequence: GETSTKEKMGPKALFSSILSLCFLVTLASASTFLSDNIFNQAEVLGSRVRVNDAALKACPVDFKKLNYTNLTAQCKGPEFSPEDCCKAFKQFACPYANYINDLTTDCLNNMAYYINLNVHYPVGLFYNKCIQGSKGLECGKQ*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_69902

• Blastp: GPI-anchored protein LLG1 from Arabidopsis with 49.52% of identity
• Blastx: GPI-anchored protein LLG1 from Arabidopsis with 49.52% of identity
• Eggnog: (GPI)-anchored protein(ENOG410YIWK)
• Kegg: Link to kegg annotations (AT5G56170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451179.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;