Protein coding transcript 130506

• Transcript: Ll_transcript_69907
• CDS coordinates: 49-429 (+)
• Peptide sequence: MSKPVFMKFAQWKAGIVPVMYRRVPCLRKGGIRFSLQGNGYWLLVYVMNVGGGGDISSMLVKGSRTGWIKMSHNWGASYQAFATLSAQTLSFRITSYTNKETIYAWNVAPSSWNVGLTYSANVNFH*
• ORF Type: complete

Annotations of Ll_transcript_69907

• Blastp: Expansin-A7 from Arabidopsis with 69.84% of identity
• Blastx: Expansin-A18 from Arabidopsis with 71.13% of identity
• Eggnog: atexpa7, exp7, atexp7, athexp alpha 1.26, expa7 atexpa7 (arabidopsis thaliana expansin a7)(ENOG410Y9MB)
• Kegg: Link to kegg annotations (AT1G12560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446514.1)
• Pfam: Pollen allergen (PF01357.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;