Protein coding transcript 130509

• Transcript: Ll_transcript_69884
• CDS coordinates: 1-426 (+)
• Peptide sequence: QDTKKIIMDTKNDVPETSNGLYNPVTHKVDTKFGQIDPVKGTLTYIDPKSGRQEVKQGIVDPTTGQLLFKGGYVNPKTNKIDPNYGRLISILITDPQINAKGEIVKRDPKHVRIDTKNNQVWVFDHNDPITKEDVYTTGHVD
• ORF Type: internal

Annotations of Ll_transcript_69884

• Blastp: Protein 4.1 homolog from Sophophora with 43.54% of identity
• Blastx: Protein 4.1 homolog from Sophophora with 43.54% of identity
• Eggnog: erythrocyte membrane protein band 4.1-like(ENOG410Y7NQ)
• Kegg: Link to kegg annotations (Dmel_CG11949)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423133.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;