Transcript | Ll_transcript_95139 |
---|---|
CDS coordinates | 1-363 (+) |
Peptide sequence | GAHGGGAFSGKDFTKVDRSAAYAARWVAKSLVKAGLCRRCLVQVSYAIGVAEPLSITIFDYGTSHKTQKELLNIVKRNFDLRPGMIVKELNLRNPIYQQTASYGHFGGNTFPWEKPKKLV* |
ORF Type | 5prime_partial |
Blastp | S-adenosylmethionine synthase from Sophophora with 82.14% of identity |
---|---|
Blastx | S-adenosylmethionine synthase from Sophophora with 82.14% of identity |
Eggnog | Catalyzes the formation of S-adenosylmethionine from methionine and ATP(COG0192) |
Kegg | Link to kegg annotations (Dmel_CG2674) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_003550837.1) |
Pfam | S-adenosylmethionine synthetase, C-terminal domain (PF02773.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer