Protein coding transcript 130513

• Transcript: Ll_transcript_95139
• CDS coordinates: 1-363 (+)
• Peptide sequence: GAHGGGAFSGKDFTKVDRSAAYAARWVAKSLVKAGLCRRCLVQVSYAIGVAEPLSITIFDYGTSHKTQKELLNIVKRNFDLRPGMIVKELNLRNPIYQQTASYGHFGGNTFPWEKPKKLV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_95139

• Blastp: S-adenosylmethionine synthase from Sophophora with 82.14% of identity
• Blastx: S-adenosylmethionine synthase from Sophophora with 82.14% of identity
• Eggnog: Catalyzes the formation of S-adenosylmethionine from methionine and ATP(COG0192)
• Kegg: Link to kegg annotations (Dmel_CG2674)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003550837.1)
• Pfam: S-adenosylmethionine synthetase, C-terminal domain (PF02773.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;