Protein coding transcript 130517

• Transcript: Ll_transcript_265320
• CDS coordinates: 1-327 (+)
• Peptide sequence: GQKGCLLLVDLSGGKLRLGGSAFAQCFKQLGDCPSDLDDCKLLSRAFAATQKLIKENVLLAGHDVSDGGLVTCLLEMAFAGLSGLLVNIDHAEEKADPLEILFAEELGW
• ORF Type: internal

Annotations of Ll_transcript_265320

• Blastp: Phosphoribosylformylglycinamidine synthase from Mus with 60.19% of identity
• Blastx: Phosphoribosylformylglycinamidine synthase from Mus with 60.19% of identity
• Eggnog: phosphoribosylformylglycinamidine synthase(COG0046)
• Kegg: Link to kegg annotations (237823)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004503568.1)
• Pfam: AIR synthase related protein, C-terminal domain (PF02769.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;