Transcript | Ll_transcript_69805 |
---|---|
CDS coordinates | 3-434 (+) |
Peptide sequence | ASLSSSKQANMMKIAVCVAVLVAVASAQQFQQFQQQQAQAPIPILKLASDIQPDGKWQYEYATGNGIQARAVGDHKPAGRDGPIHSVQGQFAWTSPEGLPVEISYVADENGYQPQGAALPTPPPIPEAILRSLEFNARYGSQE* |
ORF Type | 5prime_partial |
Blastp | Larval cuticle protein LCP-17 from Bombyx with 47.58% of identity |
---|---|
Blastx | Endocuticle structural glycoprotein SgAbd-2 from Schistocerca with 54.08% of identity |
Eggnog | Insect cuticle protein(ENOG4110RUZ) |
Kegg | Link to kegg annotations (692362) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_014631470.1) |
Pfam | Insect cuticle protein (PF00379.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer