Protein coding transcript 130522

• Transcript: Ll_transcript_69805
• CDS coordinates: 3-434 (+)
• Peptide sequence: ASLSSSKQANMMKIAVCVAVLVAVASAQQFQQFQQQQAQAPIPILKLASDIQPDGKWQYEYATGNGIQARAVGDHKPAGRDGPIHSVQGQFAWTSPEGLPVEISYVADENGYQPQGAALPTPPPIPEAILRSLEFNARYGSQE*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_69805

• Blastp: Larval cuticle protein LCP-17 from Bombyx with 47.58% of identity
• Blastx: Endocuticle structural glycoprotein SgAbd-2 from Schistocerca with 54.08% of identity
• Eggnog: Insect cuticle protein(ENOG4110RUZ)
• Kegg: Link to kegg annotations (692362)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014631470.1)
• Pfam: Insect cuticle protein (PF00379.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;