Protein coding transcript 130523

• Transcript: Ll_transcript_69810
• CDS coordinates: 3-347 (+)
• Peptide sequence: KVQKMEGKSTDVHLRAMLNSPARFTPAVPTPDWNLTPTQPQTAQPSTTNPGPTNPSIVVATPGSALGEPHTNITLQNCVATVDLHTTLDLQLVNARTRNTEYNPSRFHGVIMRIR
• ORF Type: internal

Annotations of Ll_transcript_69810

• Blastp: TBP-related factor from Sophophora with 54.72% of identity
• Blastx: TBP-related factor from Sophophora with 54.72% of identity
• Eggnog: General factor that plays a role in the activation of archaeal genes transcribed by RNA polymerase. Binds specifically to the TATA box promoter element which lies close to the position of transcription initiation (By similarity)(COG2101)
• Kegg: Link to kegg annotations (Dmel_CG7562)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013455176.1)
• Pfam: Transcription factor TFIID (or TATA-binding protein, TBP) (PF00352.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;