Protein coding transcript 130524

• Transcript: Ll_transcript_69802
• CDS coordinates: 3-320 (+)
• Peptide sequence: QRERPFACETCNKRFHSAARLKTHMNLHTGDRPFACKMCDKKFMDKDTLSSHMVVHMNVKPYQCEHCGTYCGRKHLLKKHLAMFHGEQMSKKRTPSLIHYECKICQ
• ORF Type: internal

Annotations of Ll_transcript_69802

• Blastp: Zinc finger protein Gfi-1b from Gallus with 44.71% of identity
• Blastx: Zinc finger protein Gfi-1b from Gallus with 44.71% of identity
• Eggnog: Zinc finger protein(COG5048)
• Kegg: Link to kegg annotations (395977)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464675.1)
• Pfam: Zinc finger, C2H2 type (PF00096.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;