Protein coding transcript 130527

• Transcript: Ll_transcript_265039
• CDS coordinates: 3-383 (+)
• Peptide sequence: GTKDHIKMVQRLVYRRRLSYNTKSNRRKVVRTPGGRLVYQYLKKPGKIPRCGQCKDTLRGIQPARPMERSRMPKRLKTVRRAYGGVLCHKCVKERIVRAFLIEEQKIVVKVLKAQKAAVKTKAPKK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_265039

• Blastp: 60S ribosomal protein L34 from Stegomyia with 68.07% of identity
• Blastx: 60S ribosomal protein L34 from Stegomyia with 71.43% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (NP_001237362.1)
• Pfam: Ribosomal protein L34e (PF01199.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;