Protein coding transcript 130530

• Transcript: Ll_transcript_265018
• CDS coordinates: 3-368 (+)
• Peptide sequence: NSEIKKDFYEIFSYYFDLNARWSEKSKVPKLGGPDATRQEVERFYSFWYDFKSWREYSYEDEEDKEKCQDRDERRYVDKLNKAERLRKKKEEMSRIRALVDLAYNNDPRIAKFKQEEKDRKL
• ORF Type: internal

Annotations of Ll_transcript_265018

• Blastp: DnaJ homolog subfamily C member 2 from Danio with 58.33% of identity
• Blastx: DnaJ homolog subfamily C member 2 from Danio with 58.33% of identity
• Eggnog: Transcription factor(COG5269)
• Kegg: Link to kegg annotations (403080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425794.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;