Protein coding transcript 130536

• Transcript: Ll_transcript_186493
• CDS coordinates: 190-534 (+)
• Peptide sequence: MIFIWFVESWVGKRKKTKRDLTTQIPQTQSKFTMKGNKPYVVVFITQAIYTAMILLSKVVFDHGVNNFILVFYRQAIATLFLLSFDFFCEWKTAPPSSFLTFCKISFLSFFGYV*
• ORF Type: complete

Annotations of Ll_transcript_186493

• Blastp: WAT1-related protein At5g64700 from Arabidopsis with 58.23% of identity
• Blastx: WAT1-related protein At5g64700 from Arabidopsis with 53.41% of identity
• Eggnog: EamA-like transporter family(ENOG410Y944)
• Kegg: Link to kegg annotations (AT5G64700)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430906.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;