Protein coding transcript 130538

• Transcript: Ll_transcript_32966
• CDS coordinates: 112-534 (+)
• Peptide sequence: MKNQVKQGFTKEEELLLQDFSRNVSTKSSALFYGNAFIVSAVPIWLFWRIHMMDIYSSLLLFVVVTSISTYLMALAYRNTKFSLKHKIAVKREEAVTKDVTKKLADDKKMSKKEKDERILWQKNEVADFEATTFSIFYNNA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_32966

• Blastp: Translocon-associated protein subunit gamma from Pongo with 69.5% of identity
• Blastx: Translocon-associated protein subunit gamma from Pongo with 68.09% of identity
• Eggnog: signal sequence receptor, gamma (translocon-associated protein gamma)(ENOG410XR1X)
• Kegg: Link to kegg annotations (100174364)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003623322.2)
• Pfam: Translocon-associated protein, gamma subunit (TRAP-gamma) (PF07074.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;