Protein coding transcript 130539

• Transcript: Ll_transcript_32961
• CDS coordinates: 3-332 (+)
• Peptide sequence: ANKIGTYQIAVVAKHHEVPFYVAAPLTSIDFNVNTGDNIVIEERPQVEMTHINNIRIASPGVTCWNPAFDVTPARLITGIITEKGVFRPSELSTLQSQLQDHKNSLPQL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_32961

• Blastp: Methylthioribose-1-phosphate isomerase from Sophophora with 72.73% of identity
• Blastx: Methylthioribose-1-phosphate isomerase from Sophophora with 72.73% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (Dere_GG11866)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017419771.1)
• Pfam: Initiation factor 2 subunit family (PF01008.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;