| Transcript | Ll_transcript_32956 |
|---|---|
| CDS coordinates | 2-319 (+) |
| Peptide sequence | GTQHVTLLDEQGAVYVLGDYKDGRLGMDIAENQKVPKVLSSLPQIKLATCGSDNSFVVTENNKLMAWGIGFEEKDYSDVIYYIPTDIDTTNKIEQKTIVQATSSDS |
| ORF Type | internal |
| Blastp | Regulator of chromosome condensation from Homo with 35.21% of identity |
|---|---|
| Blastx | Regulator of chromosome condensation from Homo with 35.21% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (1104) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_020202686.1) |
| Pfam | Regulator of chromosome condensation (RCC1) repeat (PF00415.17) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer