Protein coding transcript 130543

• Transcript: Ll_transcript_210154
• CDS coordinates: 3-524 (+)
• Peptide sequence: VVKLSEISMKERLALRAVKFGSPVSAEAKKVARAARFGEPTSADSKKEARAARFGLSATSVTSAGNVPEVNVDLLKKRAERFGIQPGSKDEVVEMEEKKKKRLERFGSTPNEAATNGSSKVTLSKPDATPAAVKPGRIPITAPTSTASSKVNLDDKKKQRAERFKTNTVVSAK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_210154

• Blastp: SAP domain-containing ribonucleoprotein from Pongo with 46.08% of identity
• Blastx: SAP domain-containing ribonucleoprotein from Pongo with 43.88% of identity
• Eggnog: SAP domain containing ribonucleoprotein(ENOG4111IA4)
• Kegg: Link to kegg annotations (100173904)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016207994.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;