Protein coding transcript 130544

• Transcript: Ll_transcript_32968
• CDS coordinates: 90-605 (+)
• Peptide sequence: MSRTKNRLLVRGILTPIQALTFAAVSGSLGLVTLYYGVNPVTAALGAANLFLYTSIYTPMKRLSILNTWIGSVVGAIPPLMGWAGCTGGVIDSGGLLLAGLLYAWQFPHFNALSWNLRPDYSRAGYRMMSVTNPGLCRRTALRYTIGVFGLCCAAPFCELTNIYFSIAVSPL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_32968

• Blastp: Protoheme IX farnesyltransferase, mitochondrial from Mus with 57.56% of identity
• Blastx: Protoheme IX farnesyltransferase, mitochondrial from Mus with 58.71% of identity
• Eggnog: Converts heme B (protoheme IX) to heme O by substitution of the vinyl group on carbon 2 of heme B porphyrin ring with a hydroxyethyl farnesyl side group (By similarity)(COG0109)
• Kegg: Link to kegg annotations (70383)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020235359.1)
• Pfam: UbiA prenyltransferase family (PF01040.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;