Protein coding transcript 130545

• Transcript: Ll_transcript_108374
• CDS coordinates: 3-338 (-)
• Peptide sequence: SWNSSTNFCNWGGVTCNPMHERVIQLNLQGYQLHGTISPIVANLSFLRVLDLGNNNFYGTIPQEFGRLLQLQGADLSNNTLHGEFPINMTSCFQLQELNLYGNNLIGKIPVQ
• ORF Type: internal

Annotations of Ll_transcript_108374

• Blastp: LRR receptor-like serine/threonine-protein kinase EFR from Arabidopsis with 49.11% of identity
• Blastx: LRR receptor-like serine/threonine-protein kinase EFR from Arabidopsis with 49.11% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G20480)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445115.1)
• Pfam: Leucine rich repeat N-terminal domain (PF08263.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;