Protein coding transcript 130548

• Transcript: Ll_transcript_206716
• CDS coordinates: 1-375 (+)
• Peptide sequence: DVWHFLQNLAGGVISRAAFGSSYEEGKKIFQLQKEKVEFLMKVIMKVYIPGWRFVPIPIHRRMKDIDRYIQASLQDMVNKRDQALKAGEATKNDLLGILMESNQKEIQEHGNNKDIGMSLQDIIE
• ORF Type: internal

Annotations of Ll_transcript_206716

• Blastp: Cytochrome P450 CYP72A219 from Panax with 48.41% of identity
• Blastx: Cytochrome P450 CYP72A219 from Panax with 48.41% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453665.1)
• Pfam: Cytochrome P450 (PF00067.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;