Transcript | Ll_transcript_103990 |
---|---|
CDS coordinates | 2-361 (+) |
Peptide sequence | FFEPLEPVDIRILFNNNNRPSGEANVEFGNKEDAMRAMSKDKTYMQHRYIELFMDGPVGGGPGSGGNNFSMDDMGPPNSGNGGSFGGFGNNSFGGGGSSSGGGGGNSFGNNTFSRRNDNS |
ORF Type | internal |
Blastp | Heterogeneous nuclear ribonucleoprotein H from Mus with 43.43% of identity |
---|---|
Blastx | Heterogeneous nuclear ribonucleoprotein H from Homo with 56.36% of identity |
Eggnog | heterogeneous nuclear ribonucleoprotein(ENOG410Z6M0) |
Kegg | Link to kegg annotations (59013) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_004500202.1) |
Pfam | RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer