Protein coding transcript 130558

• Transcript: Ll_transcript_210165
• CDS coordinates: 2-352 (+)
• Peptide sequence: NHWDGMLEVVGVTGVVHLGQIQSGLRSAMRIAQGGHIKIHLNSDIPVQVDGEPWVQSACDVVVLKSALKATMLKKMKGKMKRRNTEPTMLVSPGAQLAPLPSNDGESPTDPNNTTF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_210165

• Blastp: Diacylglycerol kinase theta from Homo with 54.88% of identity
• Blastx: Diacylglycerol kinase theta from Mus with 68.52% of identity
• Eggnog: DiacylGlycerol Kinase(ENOG410XQVB)
• Kegg: Link to kegg annotations (1609)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451660.1)
• Pfam: Diacylglycerol kinase accessory domain (PF00609.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;