Protein coding transcript 130565

• Transcript: Ll_transcript_266199
• CDS coordinates: 3-305 (+)
• Peptide sequence: QYHPEVNNNDDDDYSEIQLYKQMGGQLPIINNLQDLINQLRVIFESDNVNIELVNYVMNSYKSNPLDWKKYAKFDRYRYTRNLVDTGNGKYNLIALCWGEG
• ORF Type: internal

Annotations of Ll_transcript_266199

• Blastp: Cysteine dioxygenase type 1 from Danio with 65.71% of identity
• Blastx: Cysteine dioxygenase type 1 from Danio with 65.71% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (393714)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014497362.1)
• Pfam: Cysteine dioxygenase type I (PF05995.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;