Protein coding transcript 130566

• Transcript: Ll_transcript_266200
• CDS coordinates: 43-363 (+)
• Peptide sequence: MKILQGSLDEIKFAWPKEKGQQLEEIERKKIELNQVAYMNDSLGLHRVENSSNVDTAISLHLYCPPYNKCKVFNQNTGQTSSSTVTFYSTFGKRIKENKEIIEPEDN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_266200

• Blastp: Cysteine dioxygenase from Caenorhabditis with 54.74% of identity
• Blastx: Cysteine dioxygenase type 1 from Pongo with 56.52% of identity
• Eggnog: cysteine dioxygenase(ENOG410XQM4)
• Kegg: Link to kegg annotations (CBG20456)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003555533.1)
• Pfam: Cysteine dioxygenase type I (PF05995.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;