Transcript | Ll_transcript_221967 |
---|---|
CDS coordinates | 3-380 (+) |
Peptide sequence | DGRFNYPWGITTDALGFIYVCDKENHRVQVFQSDGTFVGKFGSMGSKEGQLEHPHYIAVSNTNRVVVSDSNNHRIQIFDVNGKVITSFGTEGSEEGQFKFPRGVAVDDQGYICVADSGNNRIQIFQ |
ORF Type | internal |
Blastp | RING finger protein nhl-1 from Caenorhabditis with 58.73% of identity |
---|---|
Blastx | RING finger protein nhl-1 from Caenorhabditis with 58.73% of identity |
Eggnog | nhl repeat containing protein(ENOG410XSQC) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_014495822.1) |
Pfam | NHL repeat (PF01436.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer