Protein coding transcript 130571

• Transcript: Ll_transcript_221967
• CDS coordinates: 3-380 (+)
• Peptide sequence: DGRFNYPWGITTDALGFIYVCDKENHRVQVFQSDGTFVGKFGSMGSKEGQLEHPHYIAVSNTNRVVVSDSNNHRIQIFDVNGKVITSFGTEGSEEGQFKFPRGVAVDDQGYICVADSGNNRIQIFQ
• ORF Type: internal

Annotations of Ll_transcript_221967

• Blastp: RING finger protein nhl-1 from Caenorhabditis with 58.73% of identity
• Blastx: RING finger protein nhl-1 from Caenorhabditis with 58.73% of identity
• Eggnog: nhl repeat containing protein(ENOG410XSQC)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014495822.1)
• Pfam: NHL repeat (PF01436.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;