Protein coding transcript 130575

• Transcript: Ll_transcript_221950
• CDS coordinates: 2-355 (+)
• Peptide sequence: FDDPRDAEDAVHARDGYDYDGYRLRVEFPRGNGPHRSGGGGGSSSGGGSYNRGGASGGSGRSRGPPARRSQYRVLVTGLPASGSWQDLKDHMREAGDVCYADVYKDGTGVVEFLRYDD
• ORF Type: internal

Annotations of Ll_transcript_221950

• Blastp: Serine/arginine-rich splicing factor 1A from Danio with 69.49% of identity
• Blastx: Serine/arginine-rich splicing factor 1A from Danio with 67.8% of identity
• Eggnog: Rna-binding protein(COG0724)
• Kegg: Link to kegg annotations (406288)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453087.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;