Protein coding transcript 130577

• Transcript: Ll_transcript_209580
• CDS coordinates: 95-607 (+)
• Peptide sequence: MIKYHFLSLVFFISILVYPSFTLKNKLVDDVCAKTSDYSFCIKSLYSDSRAATADRVVLAYVALDLAYLDATNTSDYIEKLIEKTSSRGDRANLEDCVADYEKAESKLAIGHNDLDSETYNALADYAGSASLAVEHCQGTIEGTYPKLHSKNHDFKGLCEIFIVVSKLFI*
• ORF Type: complete

Annotations of Ll_transcript_209580

• Blastp: Pectinesterase inhibitor from Actinidia with 31.71% of identity
• Blastx: Pectinesterase inhibitor from Actinidia with 31.71% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425125.1)
• Pfam: Plant invertase/pectin methylesterase inhibitor (PF04043.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;