Protein coding transcript 130579

• Transcript: Ll_transcript_209579
• CDS coordinates: 1-387 (+)
• Peptide sequence: WLEKYLPDEFNRIMTCSGTAGGDDSDEKKRQKRGGKGMVKSKKKDDGPKQVCLSRAPRGKKKSVTVVTGLSTFNIDLKVAAKFFGTKFACGSSVTGEDEIVIQGDVKDDLFDIIPEKWPEIDEDYIEDL
• ORF Type: internal

Annotations of Ll_transcript_209579

• Blastp: Density-regulated protein homolog from Sophophora with 73.85% of identity
• Blastx: Density-regulated protein homolog from Sophophora with 73.85% of identity
• Eggnog: translation initiation factor(COG0023)
• Kegg: Link to kegg annotations (Dmel_CG9099)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416128.1)
• Pfam: Translation initiation factor SUI1 (PF01253.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;