Protein coding transcript 130580

• Transcript: Ll_transcript_209581
• CDS coordinates: 2-301 (+)
• Peptide sequence: EEALQREMKMDEEKLEAQMEYAKYEHETEMLREQLRQRELDRERQKRDWELKERQAEEQRRQDEEMMRRQQEDMSMRMHHQEEEMRRRQQENSLFMQAHQ
• ORF Type: internal

Annotations of Ll_transcript_209581

• Blastp: Hrp65 protein from Chironomus with 73.74% of identity
• Blastx: Protein no-on-transient A from Sophophora with 70% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020201929.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;