| Transcript | Ll_transcript_187648 |
|---|---|
| CDS coordinates | 2-343 (+) |
| Peptide sequence | FAVQQNGDVPEDPSSPPPNLPFLEILSEFTNKLLKQDKRVVLNFLNRRISAGMPSSRGEDWQPLLQYRNSLVHGESDQPIVTSKRAYGRKKKDAADEGEDGGDDNANSDEEYNA |
| ORF Type | internal |
| Blastp | Cohesin subunit SA-1 from Mus with 53.23% of identity |
|---|---|
| Blastx | Cohesin subunit SA-2 from Xenopus with 43.08% of identity |
| Eggnog | Stromal antigen(COG5537) |
| Kegg | Link to kegg annotations (20842) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_014511934.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer