Protein coding transcript 130590

• Transcript: Ll_transcript_78018
• CDS coordinates: 2-424 (+)
• Peptide sequence: KDVLLSADSGCKYDQVIEIDLSTLEPHVNGPFTPDLAHPISKLKDNAKKAGWPEEIKVGLIGSCTNSSYEDMSRCATIAKEALAHGRKSKIPFNVTPGSEQIRATIERDGIAQTLREFGGTVLANACGPCIGQWDRKDVKK
• ORF Type: internal

Annotations of Ll_transcript_78018

• Blastp: Aconitate hydratase, mitochondrial from Aspergillus with 75.18% of identity
• Blastx: Aconitate hydratase, mitochondrial from Aspergillus with 75.18% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AN5525.2)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003537655.1)
• Pfam: Aconitase family (aconitate hydratase) (PF00330.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;