Protein coding transcript 130591

• Transcript: Ll_transcript_78019
• CDS coordinates: 1-354 (+)
• Peptide sequence: LEPHVNGPFTPDLAHPISKLGKNAKKNDWPVEIKVGLIGSCTNSSYEDMSRCATIAKEALAHGRKSKIPFNVTPGSEQIRATIERDGIAQTLREFGGTVLANACGPCIGQWDRKDVKK
• ORF Type: internal

Annotations of Ll_transcript_78019

• Blastp: Aconitate hydratase, mitochondrial from Homo with 74.58% of identity
• Blastx: Aconitate hydratase, mitochondrial from Homo with 74.58% of identity
• Eggnog: aconitate hydratase(COG1048)
• Kegg: Link to kegg annotations (50)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423390.1)
• Pfam: Aconitase family (aconitate hydratase) (PF00330.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;